Cyprinus carpio (common carp): 109054953 Help Entry 109054953         CDS       T05134                                  Name (RefSeq) apoptosis regulator BAX-like   KO K02159   apoptosis regulator BAX Organism ccar  Cyprinus carpio (common carp) Pathway ccar04115   p53 signaling pathway ccar04141   Protein processing in endoplasmic reticulum ccar04210   Apoptosis ccar04217   Necroptosis ccar05132   Salmonella infection ccar05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109054953  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109054953    04217 Necroptosis     109054953    04115 p53 signaling pathway     109054953  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109054953   09171 Infectious disease: bacterial    05132 Salmonella infection     109054953  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ccar03029]     109054953   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccar02000]     109054953 Mitochondrial biogenesis [BR:ccar03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     109054953 Transporters [BR:ccar02000]  Other transporters   Pores ion channels [TC:1]    109054953 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 TPR_Edg1 NMT_C Motif Other DBs NCBI-GeneID:  109054953 NCBI-ProteinID:  XP_018927727 Ensembl:  ENSCCRG00000020771 UniProt:  A0A9Q9ZCD0 LinkDB All DBs Position B3:22418483..22424356 Genome browser AA seq 145 aa AA seqDB search MACEVSQDDQIGEALLIRLVRDEVMNVADEDAAPPALPEVRPINNSQDQKLVEQLAETIK VIGDRLNKDKAFNDMIDGLVKVADKRSFWELVKKVFTNGQINWGRIIVLFYSVGKLSAKM VLAHLPKIVSDILTLCLDYFRKNLM NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcttgcgaagtctcgcaggatgaccagattggagaagcactcttaatcaggctggta agagatgaggtgatgaacgtagcagatgaggatgcagccccaccagcccttcccgaagtt cgtccaataaacaacagccaagaccagaagcttgttgaacagctggcagagaccatcaaa gtgattggtgatagactcaataaggataaagcattcaatgacatgattgatggcttagta aaagtggctgataagagaagtttctgggaacttgtgaaaaaagttttcacaaatggccag atcaactgggggagaattatagtgctgttctattcagttggaaaactgtctgcaaagatg gtccttgcacacttacccaaaattgtttcagacattttgaccttatgtctggattacttc aggaaaaatctgatg

DBGET integrated database retrieval system