Cyprinus carpio (common carp): 109059246 Help Entry 109059246         CDS       T05134                                  Name (RefSeq) GTPase KRas isoform X2   KO K07827   GTPase KRas Organism ccar  Cyprinus carpio (common carp) Pathway ccar04010   MAPK signaling pathway ccar04012   ErbB signaling pathway ccar04068   FoxO signaling pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04150   mTOR signaling pathway ccar04210   Apoptosis ccar04218   Cellular senescence ccar04370   VEGF signaling pathway ccar04371   Apelin signaling pathway ccar04540   Gap junction ccar04625   C-type lectin receptor signaling pathway ccar04810   Regulation of actin cytoskeleton ccar04910   Insulin signaling pathway ccar04912   GnRH signaling pathway ccar04914   Progesterone-mediated oocyte maturation ccar04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109059246    04012 ErbB signaling pathway     109059246    04370 VEGF signaling pathway     109059246    04371 Apelin signaling pathway     109059246    04068 FoxO signaling pathway     109059246    04150 mTOR signaling pathway     109059246  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109059246    04137 Mitophagy - animal     109059246   09143 Cell growth and death    04210 Apoptosis     109059246    04218 Cellular senescence     109059246   09144 Cellular community - eukaryotes    04540 Gap junction     109059246   09142 Cell motility    04810 Regulation of actin cytoskeleton     109059246  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109059246   09152 Endocrine system    04910 Insulin signaling pathway     109059246    04912 GnRH signaling pathway     109059246    04914 Progesterone-mediated oocyte maturation     109059246    04916 Melanogenesis     109059246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109059246   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccar04031]     109059246 Membrane trafficking [BR:ccar04131]  Endocytosis   Macropinocytosis    Ras GTPases     109059246 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109059246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N ATP_bind_1 G1_gp67_C Septin NPR1_interact Motif Other DBs NCBI-GeneID:  109059246 NCBI-ProteinID:  XP_018931987 Ensembl:  ENSCCRG00000024099 UniProt:  Q9YH38 A0ABE4YCP9 LinkDB All DBs Position B25:complement(18024279..18033813) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRSVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK SKTKCVLM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagcttgtggttgtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatatgacccgaccatagaggactcctac aggaagcaggtggtgattgacggagagacatgtctattggacatcttggacactgcaggt caggaggagtatagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt gtctttgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata aagcgagtaaaggactcggaggacgtccccatggtcttggtggggaataagtgtgatctt ccgtcccgcagtgtggacaccaagcaggctcaggatttagcgcgtagctacggcatccca tttatagagacctcagcaaagacgagacagggtgtggacgacgcattttatactctagtc cgagaaatccggaaacacaaggagaagatgagcaaggagggcaagaagaaaaagaagaaa tccaaaacaaaatgtgtattaatgtga

DBGET integrated database retrieval system