Cyprinus carpio (common carp): 109060893 Help Entry 109060893         CDS       T05134                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism ccar  Cyprinus carpio (common carp) Pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04142   Lysosome biogenesis ccar04144   Endocytosis ccar04145   Phagosome ccar04148   Efferocytosis ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109060893    04145 Phagosome     109060893    04142 Lysosome biogenesis     109060893    04140 Autophagy - animal     109060893    04137 Mitophagy - animal     109060893    04148 Efferocytosis     109060893  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109060893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109060893   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109060893    04031 GTP-binding proteins [BR:ccar04031]     109060893 Membrane trafficking [BR:ccar04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109060893 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109060893   Exosomal proteins of other body fluids (saliva and urine)    109060893   Exosomal proteins of colorectal cancer cells    109060893   Exosomal proteins of bladder cancer cells    109060893 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109060893 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 NTPase_1 AAA_7 G-alpha AAA_24 AAA_5 DUF5992 SRPRB NB-ARC ATPase_2 ABC_tran AAA_14 NACHT ATP-synt_ab Motif Other DBs NCBI-GeneID:  109060893 NCBI-ProteinID:  XP_042589026 Ensembl:  ENSCCRG00000016691 UniProt:  A0A8C1SU83 LinkDB All DBs Position B10:complement(19661401..19665293) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPVSSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggtgcttctgaaggtgataattctcggggattctggggttggg aagacttctttgatgaatcagtatgtcaataagaagttcagcaatcagtataaagccacc atcggtgcagactttcttaccaaggaggtgatggtggatgacaggctggtgacaatgcag atctgggacacggcaggacaggagcgtttccagtctttgggtgtggctttttaccgcggg gccgactgctgcgtgctggtgtatgacgtgaccgcaccgaacaccttcaaaaccctggac agctggagggatgagttcctcattcaggccagccctcgagacccggagaacttccccttt gtagtgctcggcaacaaaatcgacttggagaacagacaggtgacaacgaaacgagcccag gcgtggtgtcagagcaaaagcaatatcccgtactttgagaccagcgcaaaagaggccatc aacgtggaccaagctttccaaacgatcgctcgcaacgccctcaaacaggagtctgaggtg gagacgtacgacttcccagaccagattaaactgagagatgacagacccgtgtcctccggt gacggctgcagctgctga

DBGET integrated database retrieval system