Cyprinus carpio (common carp): 109061640 Help Entry 109061640         CDS       T05134                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ccar  Cyprinus carpio (common carp) Pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04144   Endocytosis ccar04145   Phagosome ccar04148   Efferocytosis ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109061640    04145 Phagosome     109061640    04140 Autophagy - animal     109061640    04137 Mitophagy - animal     109061640    04148 Efferocytosis     109061640  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109061640  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109061640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109061640    04031 GTP-binding proteins [BR:ccar04031]     109061640 Membrane trafficking [BR:ccar04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109061640 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109061640   Exosomal proteins of other body fluids (saliva and urine)    109061640   Exosomal proteins of colorectal cancer cells    109061640   Exosomal proteins of bladder cancer cells    109061640 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109061640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 G-alpha AAA_24 AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  109061640 NCBI-ProteinID:  XP_018934289 Ensembl:  ENSCCRG00000027229 UniProt:  A0A9Q9ZDT3 LinkDB All DBs Position A11:complement(10419406..10431047) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtgatcatccttggagactccggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggagcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggatacagcaggtcaagagcggttccagtctctgggtgtggctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcagtgccccaaacaccttcaagacactggac agctggagggacgagttcctgatccaggccagcccacgtgacccagagaacttccccttc gtggtgctgggcaacaaaatcgatctggagaataggcaggtaacaaccaagcgggcacag gcttggtgtcagagtaagaacaacatcccgtactttgagaccagtgcaaaggaggccatc aatgtagagcaggctttccagaccatcgcgcgcaatgcactcaaacaggaaaccgaagtg gagttatacaacgagttccccgagccaattaaactagaccgaaatgatagagccaagcca tcagcagagacttgtagctgctga

DBGET integrated database retrieval system