Cyprinus carpio (common carp): 109062479 Help Entry 109062479         CDS       T05134                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism ccar  Cyprinus carpio (common carp) Pathway ccar04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109062479  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccar04121]     109062479    03400 DNA repair and recombination proteins [BR:ccar03400]     109062479 Ubiquitin system [BR:ccar04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109062479    Cul5 complex      109062479 DNA repair and recombination proteins [BR:ccar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109062479 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  109062479 NCBI-ProteinID:  XP_018935115 Ensembl:  ENSCCRG00000049709 UniProt:  A0A8C1FF69 LinkDB All DBs Position A2:complement(14647884..14649646) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagaaaaaacctatggtggctgtgaagggccagatgccatgtacgtgaaa ttgatctcctctgatggccatgagtttattgtgaagagagaacatgctcttacatctgga acaatcaaagctatgcttagtggacctggccagtttgctgagaatgaaacaaatgaggtc aactttcgagagatcccatctcacgttctttctaaagtgtgcatgtactttacatataaa gtccgctatactaatagctcaacagaaatcccagaatttcctattgccccagaaatagct ctggagcttctgatggctgcaaacttcctagattgttaa

DBGET integrated database retrieval system