Cyprinus carpio (common carp): 109068055 Help Entry 109068055         CDS       T05134                                  Symbol dctn6 Name (RefSeq) dynactin subunit 6   KO K10428   dynactin 6 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04814   Motor proteins ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     109068055 (dctn6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109068055 (dctn6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccar03036]     109068055 (dctn6)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccar04812]     109068055 (dctn6) Chromosome and associated proteins [BR:ccar03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      109068055 (dctn6) Cytoskeleton proteins [BR:ccar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      109068055 (dctn6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hexapep DCTN5 Motif Other DBs NCBI-GeneID:  109068055 NCBI-ProteinID:  XP_018940465 Ensembl:  ENSCCRG00000025580 UniProt:  A0A9Q9V670 LinkDB All DBs Position A7:46528386..46532334 Genome browser AA seq 109 aa AA seqDB search MSIGINNVFEVGCVSQALKIGDNNVIESKAEVGRNVILSSGCIVGACCQVNTCEVIQENT VIYGSECLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTVKGNSTPARS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcattgggatcaataacgtgtttgaagtcggctgcgtgtctcaggccttgaaaatt ggggacaacaacgtcattgaatccaaagctgaggtcgggaggaacgtgatcctgagcagc ggatgcatcgttggcgcgtgttgtcaggtgaacacgtgtgaagtgattcaagaaaacacg gttatctacggctctgagtgtttgagacgcgtgcagactgaaagaccgcagcctcaaacg ctgcagctggacttcctgatgaagattttgcccaattaccatcatctgaagaaaacagtg aaaggaaattccactccggcgagaagctaa

DBGET integrated database retrieval system