Cyprinus carpio (common carp): 109070813 Help Entry 109070813         CDS       T05134                                  Name (RefSeq) GTPase HRas isoform X3   KO K02833   GTPase HRas Organism ccar  Cyprinus carpio (common carp) Pathway ccar04010   MAPK signaling pathway ccar04012   ErbB signaling pathway ccar04068   FoxO signaling pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04144   Endocytosis ccar04150   mTOR signaling pathway ccar04210   Apoptosis ccar04218   Cellular senescence ccar04370   VEGF signaling pathway ccar04371   Apelin signaling pathway ccar04510   Focal adhesion ccar04540   Gap junction ccar04625   C-type lectin receptor signaling pathway ccar04810   Regulation of actin cytoskeleton ccar04910   Insulin signaling pathway ccar04912   GnRH signaling pathway ccar04916   Melanogenesis ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109070813    04012 ErbB signaling pathway     109070813    04370 VEGF signaling pathway     109070813    04371 Apelin signaling pathway     109070813    04068 FoxO signaling pathway     109070813    04150 mTOR signaling pathway     109070813  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109070813    04140 Autophagy - animal     109070813    04137 Mitophagy - animal     109070813   09143 Cell growth and death    04210 Apoptosis     109070813    04218 Cellular senescence     109070813   09144 Cellular community - eukaryotes    04510 Focal adhesion     109070813    04540 Gap junction     109070813   09142 Cell motility    04810 Regulation of actin cytoskeleton     109070813  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109070813   09152 Endocrine system    04910 Insulin signaling pathway     109070813    04912 GnRH signaling pathway     109070813    04916 Melanogenesis     109070813  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109070813  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109070813   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109070813    04031 GTP-binding proteins [BR:ccar04031]     109070813 Membrane trafficking [BR:ccar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109070813  Endocytosis   Macropinocytosis    Ras GTPases     109070813 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109070813   Exosomal proteins of colorectal cancer cells    109070813 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109070813 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 Septin FeoB_N G-alpha Ldh_1_N nSTAND3 ParA CbiA AAA_16 Motif Other DBs NCBI-GeneID:  109070813 NCBI-ProteinID:  XP_018942865 Ensembl:  ENSCCRG00000029705 UniProt:  A0A9Q9V653 LinkDB All DBs Position B25:complement(19539851..19559130) Genome browser AA seq 152 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRMVDTRQAQELARSYGIPFIETSAKTRQQN NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggacgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggggagacgtgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc aagcgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgtgacctc ccgacccggatggtggacacacggcaagcgcaggagctcgcgcgcagctacgggatcccc ttcatcgagacctcagccaaaacacgacagcaaaactag

DBGET integrated database retrieval system