Cyprinus carpio (common carp): 109071525 Help Entry 109071525         CDS       T05134                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04382   Cornified envelope formation ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109071525  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109071525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109071525 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of microglial cells    109071525 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  109071525 NCBI-ProteinID:  XP_018943509 Ensembl:  ENSCCRG00000035430 UniProt:  A0A8C1DQZ3 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGKSGTLTRRELRILMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatccgagctagagactgccatggagtccctcatcatggtattccaccgctacgct ggaaaagagggcaagagcggcaccctgacccgccgtgaactccgaatcctgatggagaac gagctctctgggtttctcaagtctcagaaggatccgaccaccatagacagaataatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcttgtgaggcgtgctatagaatgcagttaaagaagacacagagctgg aaatga

DBGET integrated database retrieval system