Cyprinus carpio (common carp): 109075503 Help Entry 109075503         CDS       T05134                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism ccar  Cyprinus carpio (common carp) Pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04142   Lysosome biogenesis ccar04144   Endocytosis ccar04145   Phagosome ccar04148   Efferocytosis ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109075503    04145 Phagosome     109075503    04142 Lysosome biogenesis     109075503    04140 Autophagy - animal     109075503    04137 Mitophagy - animal     109075503    04148 Efferocytosis     109075503  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109075503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109075503   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109075503    04031 GTP-binding proteins [BR:ccar04031]     109075503 Membrane trafficking [BR:ccar04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109075503 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109075503   Exosomal proteins of other body fluids (saliva and urine)    109075503   Exosomal proteins of colorectal cancer cells    109075503   Exosomal proteins of bladder cancer cells    109075503 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109075503 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP Septin nSTAND3 AAA_7 NTPase_1 AAA_16 AAA_22 G-alpha ATPase_2 SRPRB AAA_24 AAA_5 ABC_tran NB-ARC ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  109075503 NCBI-ProteinID:  XP_042618725 Ensembl:  ENSCCRG00000044991 UniProt:  A0A8C1JVA3 LinkDB All DBs Position A8:complement(21796947..21805105) Genome browser AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTMDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQESVE TYDFPDQIKLRDDRPVSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaagaaggtgctgctcaaagtgatcatcctaggggattctggagttggg aagacctctttgatgaaccagtatgtgaataataagttcagtaatcagtataaggccact attggagccgacttcctgactaaggaggtgatggtggacgacagactggtcaccatgcag atttgggacacggcgggacaggagcgctttcagtctctgggcgtggctttctacagaggg gcggactgctgcgtgctggtgtacgacgtcacggcacccactacattcaagactatggac agctggagggacgagtttctcattcaggccagtcctcgtgacccggagaacttccccttt gttgtgctgggcaacaaaatcgacctggagaaccggcaggtgacgacaaagcgagctcaa gcgtggtgtcagagtaagaacaacatcccctattttgagaccagtgccaaagaagccatt aacgtggaccaggccttccaaactatcgctcgcaatgcacttaaacaggagtcggtggag acgtatgacttccctgaccagattaaactgagagacgacagaccggtgtctagcagcgat ggctgcagctgctga

DBGET integrated database retrieval system