Cyprinus carpio (common carp): 109078242 Help Entry 109078242         CDS       T05134                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04060   Cytokine-cytokine receptor interaction ccar04218   Cellular senescence ccar04620   Toll-like receptor signaling pathway ccar04621   NOD-like receptor signaling pathway ccar04622   RIG-I-like receptor signaling pathway ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109078242  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccar04052]     109078242    00536 Glycosaminoglycan binding proteins [BR:ccar00536]     109078242 Cytokines and neuropeptides [BR:ccar04052]  Cytokines   Chemokines    109078242 Glycosaminoglycan binding proteins [BR:ccar00536]  Heparan sulfate / Heparin   Chemokines    109078242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109078242 NCBI-ProteinID:  XP_018949086 Ensembl:  ENSCCRG00000043692 UniProt:  A0A8C1WFN5 LinkDB All DBs Position B7:complement(6337773..6340406) Genome browser AA seq 100 aa AA seqDB search MMKLSTSAFMLLICTAALLSTTEGRIKPMHLRCQCIQTYSGPAIPFGKIQSLRMIPAGPN CKNEEIIAKMRKLKMCLNPAKDWVISLKEKFNQKNVTSQQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgatgaagttaagcacatctgccttcatgcttctgatctgcacagctgcactgctgtcc acaacagagggtagaattaaacccatgcatctacgctgtcaatgcattcaaacatattca gggccagcaatcccttttggaaaaatacagtcattgaggatgattcctgctggaccaaac tgcaaaaatgaggagatcattgccaaaatgaggaaattaaagatgtgcctcaatcctgca aaagactgggtgatttctctcaaagaaaaatttaaccagaagaacgtcacaagccaacag tga

DBGET integrated database retrieval system