Cyprinus carpio (common carp): 109078337 Help Entry 109078337         CDS       T05134                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04810   Regulation of actin cytoskeleton ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109078337 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109078337 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  109078337 NCBI-ProteinID:  XP_018949182 Ensembl:  ENSCCRG00000025596 UniProt:  A0A8C1W3W5 LinkDB All DBs Position B11:10080836..10082743 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggacaggaggatcccgtgcaaagggaaattcatcaagactgggcgaaccgtgaa tatatcgaagtgatcaccagcagcattaagaaaatagccgatttcctcaattccttcgat atgtcctgcaggtcccgtttagccactttgaatgagaagcttactgctttggagaggagg attgagtacattgaagccagagtcacaaaaggggaaaccttgacctag

DBGET integrated database retrieval system