Cyprinus carpio (common carp): 109080861 Help Entry 109080861         CDS       T05134                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism ccar  Cyprinus carpio (common carp) Brite KEGG Orthology (KO) [BR:ccar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccar03036]     109080861   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109080861 Chromosome and associated proteins [BR:ccar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109080861 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109080861 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  109080861 NCBI-ProteinID:  XP_042609293 UniProt:  A0A9R0ASL3 LinkDB All DBs Position B25:21842824..21843803 Genome browser AA seq 106 aa AA seqDB search MTSFRRLFNEFLLVTESKGNCQNRYQKSNKLLIRKLPFQRLVREIAQDFKTDLRFQSSAV MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgacgtcttttcgacgtcttttcaacgagtttttgctggtgaccgaatcgaaagggaac tgtcagaaccgctatcagaagtccaacaagctgctgatccgcaagctgcccttccagcgt ctggtgcgagagatcgctcaggacttcaagacggacctgcgcttccagagctccgctgtc atggccctgcaggaggccagcgaggcttatttggtcggtctgttcgaggacaccaacctg tgcgccatccacgccaagagagtcaccatcatgcccaaagacatccagctggcgcgccgc atccgtggagagcgcgcttaa

DBGET integrated database retrieval system