Cyprinus carpio (common carp): 109082596 Help Entry 109082596         CDS       T05134                                  Name (RefSeq) centromere protein X-like   KO K15360   centromere protein X Organism ccar  Cyprinus carpio (common carp) Pathway ccar03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     109082596  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ccar03400]     109082596 DNA repair and recombination proteins [BR:ccar03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      109082596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF TAFII28 PPV_E1_DBD HyaE COMMD9_HN Motif Other DBs NCBI-GeneID:  109082596 NCBI-ProteinID:  XP_018952993 Ensembl:  ENSCCRG00000041923 UniProt:  A0A8C2ELD4 LinkDB All DBs Position A3:34424940..34427496 Genome browser AA seq 81 aa AA seqDB search MANAGNEVAFKKETVSKLLTRSFKEDKTKVSSDAVILVAELLKVFVEEATRRAVKQADSE DCDTIDIEHFEKILPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgcgggaaatgaagtcgcgtttaaaaaggaaactgtttccaaacttttgaca cgctcttttaaggaggataaaaccaaagtcagcagtgatgctgtcatacttgtagcagag ctgctgaaagtatttgttgaagaggcgacacgcagagctgttaaacaggctgacagtgag gattgtgacactattgatattgagcactttgaaaagattctgccacaattgcttcttgac ttttaa

DBGET integrated database retrieval system