Cyprinus carpio (common carp): 109083629 Help Entry 109083629         CDS       T05134                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ccar  Cyprinus carpio (common carp) Pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04144   Endocytosis ccar04145   Phagosome ccar04148   Efferocytosis ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109083629    04145 Phagosome     109083629    04140 Autophagy - animal     109083629    04137 Mitophagy - animal     109083629    04148 Efferocytosis     109083629  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109083629  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109083629   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109083629    04031 GTP-binding proteins [BR:ccar04031]     109083629 Membrane trafficking [BR:ccar04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109083629 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109083629   Exosomal proteins of other body fluids (saliva and urine)    109083629   Exosomal proteins of colorectal cancer cells    109083629   Exosomal proteins of bladder cancer cells    109083629 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109083629 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  109083629 NCBI-ProteinID:  XP_018953947 Ensembl:  ENSCCRG00000034789 UniProt:  A0A8C2BMV4 LinkDB All DBs Position B11:19110283..19120741 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtcatcattcttggagactctggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggagcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggacacagcaggtcaagagcggttccagtctctgggtgtggctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcactgcccctaacaccttcaagacactggac agctggagggacgagtttctcatccaggccagcccgcgcgacccagagaacttccccttt gtggtgctgggcaacaaaatcgatctggagaataggcaggtaacaaccaagcgggcacag gcttggtgtcagagtaagaacaacatcccgtattttgagaccagtgcaaaggaggccatc aacgtagagcaggctttccagaccatcgcacgcaatgcactcaaacaggaaactgaagtg gagttatacaacgagttcccggagccaattaaactagaccggaacgatagagccaagcca tcagcagaggcttgcagctgctga

DBGET integrated database retrieval system