Cyprinus carpio (common carp): 109084683 Help Entry 109084683         CDS       T05134                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ccar  Cyprinus carpio (common carp) Pathway ccar04010   MAPK signaling pathway ccar04012   ErbB signaling pathway ccar04068   FoxO signaling pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04150   mTOR signaling pathway ccar04210   Apoptosis ccar04218   Cellular senescence ccar04370   VEGF signaling pathway ccar04371   Apelin signaling pathway ccar04540   Gap junction ccar04625   C-type lectin receptor signaling pathway ccar04810   Regulation of actin cytoskeleton ccar04910   Insulin signaling pathway ccar04912   GnRH signaling pathway ccar04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109084683    04150 mTOR signaling pathway     109084683  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109084683    04137 Mitophagy - animal     109084683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109084683   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109084683    04031 GTP-binding proteins [BR:ccar04031]     109084683 Membrane trafficking [BR:ccar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109084683  Endocytosis   Macropinocytosis    Ras GTPases     109084683 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109084683   Exosomal proteins of other body fluids (saliva and urine)    109084683   Exosomal proteins of breast cancer cells    109084683   Exosomal proteins of colorectal cancer cells    109084683 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109084683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  109084683 NCBI-ProteinID:  XP_042617704 Ensembl:  ENSCCRG00000045467 UniProt:  A0A8C2KUM2 LinkDB All DBs Position A8:complement(5955281..5962640) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagttggtggttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcagaatcactttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtcattgacggtgagacgtgtctgctggatatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaataacagcaaatcctttgcagatgtgcatttgtacagagaacagatc aagcgcgtgaaggactccgatgatgttcccatggtcctagtggggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt gtagaaacttctgccaagaccagacagggagttgaggatgctttttacacccttgtccgt gagatccggcattatcgcatgaaaaagctcaacagcagagaagacagaaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system