Cyprinus carpio (common carp): 109085106 Help Entry 109085106         CDS       T05134                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism ccar  Cyprinus carpio (common carp) Pathway ccar04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109085106  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccar04121]     109085106    03400 DNA repair and recombination proteins [BR:ccar03400]     109085106 Ubiquitin system [BR:ccar04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109085106    Cul5 complex      109085106 DNA repair and recombination proteins [BR:ccar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109085106 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  109085106 NCBI-ProteinID:  XP_018955296 UniProt:  A0A9Q9XYM4 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDVEERTYGGCEGPDAMYVKLISSDGQEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatgttgaagagcggacttatggtggttgtgaaggcccggatgccatgtatgtaaag ctgatctcttcagatggccaggagttcattgtgaagagagagcatgctttaacctctggc accatcaaggctatgctgagtggacctggtcagtttgcggaaaatgaaaccaacgaggtg aacttccgggagatcccgtctcatgttctctccaaagtctgcatgtattttacctataaa gtgcgttataccaacagctcgacagagatcccagaattccccattgctcctgagattgcc ctggaattgcttatggctgcaaactttctcgactgttag

DBGET integrated database retrieval system