Cyprinus carpio (common carp): 109086941 Help Entry 109086941         CDS       T05134                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism ccar  Cyprinus carpio (common carp) Pathway ccar04810   Regulation of actin cytoskeleton ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109086941  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109086941  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109086941   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccar04812]     109086941    04147 Exosome [BR:ccar04147]     109086941 Membrane trafficking [BR:ccar04131]  Others   Actin-binding proteins    Others     109086941 Cytoskeleton proteins [BR:ccar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109086941 Exosome [BR:ccar04147]  Exosomal proteins   Proteins found in most exosomes    109086941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109086941 NCBI-ProteinID:  XP_042567337 UniProt:  A0A9Q9ZMU1 LinkDB All DBs Position A21:24444746..24446953 Genome browser AA seq 118 aa AA seqDB search MSWDSYITSLTKSEWVDDAVILGCTPGQESVWAAAPGGWLNQVSASEVKAIIASDRSTLF ANGVTLAGRKCTVLRDALNVDGQNTMDIKMKTSEKEPDPFSFTIGRSHKGENIKQHNI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagctgggacagctacatcactagcctgaccaagagcgagtgggtggatgatgcggtc atcctcggatgcacaccgggtcaggagtccgtttgggcggcagcaccgggcggctggctg aaccaagtctcggcgtctgaggtcaaggctatcatcgccagtgaccgcagtactctgttt gccaatggagtgactctggccggcaggaagtgcacggtgctgagagacgctctgaatgtg gacggccagaacaccatggacatcaagatgaagacctcagagaaagagcccgaccccttc tccttcaccatcggcagatctcacaaaggtgaaaatataaaacagcacaatatatga

DBGET integrated database retrieval system