Cyprinus carpio (common carp): 109096687 Help Entry 109096687         CDS       T05134                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04382   Cornified envelope formation ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109096687  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109096687  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109096687 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of microglial cells    109096687 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  109096687 NCBI-ProteinID:  XP_018965868 UniProt:  A0A9Q9VDZ5 LinkDB All DBs Position A16:8490751..8492303 Genome browser AA seq 105 aa AA seqDB search MPSDLERAMETLITVFHRYASKEAGNTSTLSRKELKMLMEAELASFLKSQKDPAAIDKLM KDLDANSDGEVNFEEFVSLVVGLSIACEQIYKIHMKQGPGGVKKQ NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagacgctgatcacagtgtttcaccgttatgcg agcaaagaggctggaaatacatcaacattaagtcgcaaagagctcaaaatgctgatggag gcagagttggctagctttctgaagtctcagaaggaccctgctgccatagacaagcttatg aaggatttggatgctaatagtgatggagaggtgaattttgaagagtttgtgtctcttgtg gtgggcctgtccattgcctgtgaacagatctacaagatacacatgaagcaggggccaggg ggtgtcaaaaagcaataa

DBGET integrated database retrieval system