Cyprinus carpio (common carp): 109096751 Help Entry 109096751         CDS       T05134                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ccar  Cyprinus carpio (common carp) Pathway ccar03010   Ribosome ccar04120   Ubiquitin mediated proteolysis ccar04137   Mitophagy - animal ccar04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     109096751   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109096751  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109096751    04137 Mitophagy - animal     109096751  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ccar03011]     109096751    04121 Ubiquitin system [BR:ccar04121]     109096751 Ribosome [BR:ccar03011]  Ribosomal proteins   Eukaryotes    Large subunit     109096751   Archaea     109096751 Ubiquitin system [BR:ccar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    109096751 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_5 Rad60-SLD_2 SAND Motif Other DBs NCBI-GeneID:  109096751 NCBI-ProteinID:  XP_042609243 UniProt:  A0A9Q9XWE0 LinkDB All DBs Position B25:967844..970495 Genome browser AA seq 119 aa AA seqDB search MSVKIFIVELTGQRRTVCVDSEELKNMTVEEFKRRFFHEEEYQWGIRLIFEGKQLEDART LGSYGILNESTIFALPRIRGGGPPPPEDEDKRIPRTESMEALASMQQTEPEPNRSCLIL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagtgtcaaaatttttattgtcgagctgacaggacagcgaagaacagtatgtgtggat tcagaggaactgaagaacatgactgttgaagagttcaaaagaagattctttcacgaagaa gaataccaatggggcatcagattaatcttcgagggcaaacaactggaggatgctcgtaca cttggttcttatggcatactaaacgaatctactatatttgcacttcctcgtatacgtggt ggaggtccacctccacctgaagatgaagataaaagaatacccaggactgaatcaatggaa gcattagcttcaatgcagcagactgagccagaacccaacagatcatgtctgattctgtag

DBGET integrated database retrieval system