Cyprinus carpio (common carp): 109105907 Help Entry 109105907         CDS       T05134                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04382   Cornified envelope formation ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109105907  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109105907  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109105907 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of microglial cells    109105907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_6 Astro_p19 EH Motif Other DBs NCBI-GeneID:  109105907 NCBI-ProteinID:  XP_018974740 Ensembl:  ENSCCRG00000006894 UniProt:  A0A8C0YQS6 LinkDB All DBs Position B16:14176529..14178023 Genome browser AA seq 105 aa AA seqDB search MPSDLERAMETLIIVFHRYASKASGNPSTLNRKELKMLMETELSSFLKSQKDPAAVDRIM RDLDSNGDGEVNFEEFVSLVVGLSIACEQLYQFKQRQQAGGVKKQ NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagacgctgatcatagtgtttcatcgttatgcg agcaaagccagtggaaatccatcaacattaaatcgcaaagagctcaaaatgctgatggag acagagttgtccagctttctgaagtctcagaaggaccctgctgctgtagacaggattatg agggatttggacagtaatggtgatggagaggtgaattttgaagagtttgtgtctcttgtg gtgggcctgtccattgcctgcgaacagctctaccagtttaagcagaggcagcaggcaggg ggtgtcaaaaagcaataa

DBGET integrated database retrieval system