Cyprinus carpio (common carp): 109107109 Help Entry 109107109         CDS       T05134                                  Symbol pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism ccar  Cyprinus carpio (common carp) Pathway ccar04810   Regulation of actin cytoskeleton ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109107109 (pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109107109 (pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109107109 (pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccar04812]     109107109 (pfn4)    04147 Exosome [BR:ccar04147]     109107109 (pfn4) Membrane trafficking [BR:ccar04131]  Others   Actin-binding proteins    Others     109107109 (pfn4) Cytoskeleton proteins [BR:ccar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109107109 (pfn4) Exosome [BR:ccar04147]  Exosomal proteins   Proteins found in most exosomes    109107109 (pfn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin ABM Motif Other DBs NCBI-GeneID:  109107109 NCBI-ProteinID:  XP_018975937 Ensembl:  ENSCCRG00000043789 UniProt:  A0A9Q9VI93 LinkDB All DBs Position B17:complement(15749319..15751866) Genome browser AA seq 127 aa AA seqDB search MNPFPKLLLGCLIDTKHVESAAIFVAKTGDVTAASNFTVCPEQTQTFLDAFKQVNVTRQR GLAFRSKHYSCVRADKHSIYTKCEGHGLILVRTALYVIVATYSQSMYPSICVEAVEKLAE YLREKGI NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaacccatttccaaagttattattaggctgtctcattgacacaaaacatgtagagtcc gcagcgatatttgtggcgaaaactggcgacgtaacggcagcgtccaactttacagtctgt ccagaacaaacacagacgtttctagacgcattcaagcaagtgaatgtaacgaggcagaga ggactcgccttcaggagcaaacactacagctgtgtgcgtgctgacaaacactccatatac actaaatgtgaaggacatggtctgatattggtgagaactgcgctgtatgtgattgttgcc acatattcacagagcatgtatccaagtatctgtgtggaagcagttgagaaactagccgag tatctgcgtgaaaagggaatctga

DBGET integrated database retrieval system