Cyprinus carpio (common carp): 109108046 Help Entry 109108046         CDS       T05134                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ccar  Cyprinus carpio (common carp) Pathway ccar04621   NOD-like receptor signaling pathway ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109108046 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109108046 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccar03110]     109108046 (txn) Chaperones and folding catalysts [BR:ccar03110]  Protein folding catalysts   Protein disulfide isomerase    109108046 (txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA OST3_OST6 DIM1 Thioredoxin_8 Thioredoxin_9 Thioredoxin_7 Redoxin Thioredoxin_2 TXD17-like_Trx Motif Other DBs NCBI-GeneID:  109108046 NCBI-ProteinID:  XP_018976765 Ensembl:  ENSCCRG00000028080 UniProt:  A0A8C2HF34 LinkDB All DBs Position B7:complement(14179680..14182807) Genome browser AA seq 107 aa AA seqDB search MIIIIEDKPAFDNALKNAGDKLVVVDFTATWCGPCQNIGPVFKELSEKQENSNVVFLKVD VDDAQDVATFCDVKCMPTFHFYKNGKKIDEFSGSNKAKLEEMLNKHK NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgattatcataattgaggataagcctgccttcgacaatgctctgaaaaatgccggggac aagttggtggtggtggacttcacagccacatggtgtgggccctgccagaacatcggtcca gtctttaaagagctgtctgaaaaacaagagaacagtaatgtcgtgtttctaaaagtggat gtggatgatgcacaggatgtggccactttctgtgacgtcaaatgtatgccaacattccat ttctacaagaatggaaagaagattgatgaattttctggatcaaataaagctaagctggag gagatgctcaataagcataaatga

DBGET integrated database retrieval system