Cyprinus carpio (common carp): 109109546 Help Entry 109109546         CDS       T05134                                  Name (RefSeq) dynactin subunit 3-like   KO K10425   dynactin 3 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04145   Phagocytosis ccar04814   Motor proteins ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     109109546   09142 Cell motility    04814 Motor proteins     109109546  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109109546  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccar03036]     109109546   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccar04812]     109109546 Chromosome and associated proteins [BR:ccar03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      109109546 Cytoskeleton proteins [BR:ccar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      109109546 SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 IES5 STB2_C UBA_E1_SCCH DUF6827 At4g38062_N Mating_N Beta-barrel_RND_rel ZapB SlyX Motif Other DBs NCBI-GeneID:  109109546 NCBI-ProteinID:  XP_018978192 LinkDB All DBs Position A16 Genome browser AA seq 113 aa AA seqDB search KYIIAVPDAVKLEFILAEEEFLRSQATLLEQVHNLQPLLDSSHIKAVPELTTKVQRLSQV HIKQQDQNEELSAEVKKLFEEYNKMMLLLSKQFSQWDEALRELEGPKQGQQID NT seq 342 nt NT seq  +upstreamnt  +downstreamnt aagtacatcatcgctgtgccagatgcagtgaagttagagtttattctggcagaggaagag tttctgcgatctcaggccacgttactggagcaggtgcacaatctgcagcctcttctggac agcagtcacattaaagcggttccagagctgaccacgaaagtgcagcggttgtcacaagtc cacattaaacaacaggaccagaatgaagagttatctgctgaagtgaagaagctgtttgaa gagtacaacaaaatgatgttgctcttatcaaagcagttttctcagtgggatgaagctctc cgggagctggaaggacccaagcaaggccagcagatagactag

DBGET integrated database retrieval system