Cyprinus carpio (common carp): 109111287 Help Entry 109111287         CDS       T05134                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04145   Phagocytosis ccar04814   Motor proteins ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     109111287 (dynlt3)   09142 Cell motility    04814 Motor proteins     109111287 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109111287 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccar03037]     109111287 (dynlt3)    04812 Cytoskeleton proteins [BR:ccar04812]     109111287 (dynlt3) Cilium and associated proteins [BR:ccar03037]  Motile cilia and associated proteins   Dynein arm    109111287 (dynlt3) Cytoskeleton proteins [BR:ccar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109111287 (dynlt3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  109111287 NCBI-ProteinID:  XP_018979774 UniProt:  A0A8C1Y7I6 LinkDB All DBs Position B11 Genome browser AA seq 115 aa AA seqDB search MEEYHSGDEVAFSPDDASNVVKECIEGIVGGVDYSQNKVNQWTASIVEHTLTQLVKQGKP FKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCVVSVFAVAIAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtatcattctggagatgaagtggctttcagtccagatgatgcaagtaatgtt gtaaaggagtgcattgagggtattgttggaggtgtggactacagccagaacaaagtcaac cagtggacagccagcatagtcgaacacactctcactcagttagtcaaacaggggaaaccg ttcaagtacattgtcaactgtgctgtgatgcagaaaagcggcgccggtcttcacacagcc aactcttgttactgggacactaccactgatggaagctgcacagtcaggtgggagaaccgc accatgtactgcgtcgtcagtgtgtttgcagtggctattgcactataa

DBGET integrated database retrieval system