Cyprinus carpio (common carp): 109113793 Help Entry 109113793         CDS       T05134                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ccar  Cyprinus carpio (common carp) Pathway ccar04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109113793  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccar04121]     109113793    03400 DNA repair and recombination proteins [BR:ccar03400]     109113793 Ubiquitin system [BR:ccar04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109113793    Cul5 complex      109113793 DNA repair and recombination proteins [BR:ccar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109113793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  109113793 NCBI-ProteinID:  XP_042580837 UniProt:  A0A8C2DXF8 LinkDB All DBs Position A3:23294127..23298238 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDMLLEDSKTLGDS GFTNQTARPQAPATVGLAFRISDDAFESLRIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttgatgatcagacgtcacaagacaaccatcttcacagatgctaaggag tctaccacagtctacgagctgaagcggattgtggagggcatcctaaagcgagcgccagag gatcagagactttataaggatgacatgctgttagaagatagtaagactcttggagactct gggttcacaaaccagacagccaggcctcaggctccggccacagtaggactggcttttcgc atcagtgatgatgcttttgagtctctaagaatagaggccttctccagccctcctgagctt cctgatgttatgaagcctcaagactcgggcagcactgccaacgaacaagccgtgcagtga

DBGET integrated database retrieval system