Cyprinus carpio (common carp): 122140251 Help Entry 122140251         CDS       T05134                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism ccar  Cyprinus carpio (common carp) Brite KEGG Orthology (KO) [BR:ccar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ccar03029]     122140251 Mitochondrial biogenesis [BR:ccar03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     122140251 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Rhodo_GlycoT WDR93 Inovirus_G7P_2 Motif Other DBs NCBI-GeneID:  122140251 NCBI-ProteinID:  XP_042599043 UniProt:  A0A9Q9XC17 LinkDB All DBs Position B17 Genome browser AA seq 87 aa AA seqDB search MRLLFTRVLPPTASCGRTEVNMADVSERTLQVAIVVSFAAGFIAGWQANRMRRRFLDWRK KRLQDKLAETPQKNTPNKTQTAMVIKV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcgacttctattcacacgcgtgcttcctccaacagcgagctgtggccgaacggaggtg aacatggccgatgtgtcggagaggacgttacaggtcgctatagtcgtttcgtttgcagct ggttttatcgccggctggcaggcaaacaggatgcgaagaaggttcttggactggcggaaa aagaggttacaggacaagctcgcagaaacaccacaaaaaaacacacctaacaagacacaa actgccatggtcatcaaagtctga

DBGET integrated database retrieval system