Cyprinus carpio (common carp): 122143731 Help Entry 122143731         CDS       T05134                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ccar  Cyprinus carpio (common carp) Pathway ccar03082   ATP-dependent chromatin remodeling ccar04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122143731  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122143731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccar03036]     122143731   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     122143731 Chromosome and associated proteins [BR:ccar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122143731 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122143731 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF ParE_like Motif Other DBs NCBI-GeneID:  122143731 NCBI-ProteinID:  XP_042610264 UniProt:  A0A9Q9XYB8 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLLRKGNYAERVGAGAPVYLAAVLEYL TAEILELAGKAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK KTEKPAKAK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtggacgaggcaaaactggcggcaaggcgagagcgaaggccaagactcgctcctcc agagcagggctgcagttccccgtcggtcgtgttcacagacttcttctccgcaaagggaac tacgcagagcgcgtcggtgccggagctcccgtctatctggcggctgtgctcgagtatctg accgctgagatcctggagttggctggaaaagccgcaagagacaacaagaagactcgcatc attccccgtcacctgcagctggcggtgcgcaacgacgaggagctcaacaaactcctgggc cgagtgaccatcgctcagggcggcgtgctgcccaacatccaggccgtgctgctgcccaag aagaccgagaaacccgccaaagccaagtaa

DBGET integrated database retrieval system