Cyprinus carpio (common carp): 122145027 Help Entry 122145027         CDS       T05134                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ccar  Cyprinus carpio (common carp) Pathway ccar03082   ATP-dependent chromatin remodeling ccar04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122145027  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122145027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccar03036]     122145027   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     122145027 Chromosome and associated proteins [BR:ccar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122145027 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122145027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  122145027 NCBI-ProteinID:  XP_042612207 UniProt:  A0A9Q9Y212 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAVAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtggtagaggcaaaaccggcggtaaggccagagcgaaggctaagactcgctcctcc agagcaggactgcagttccccgtcggtcgtgttcacagacttctccgcaaaggcaactac gccgagcgcgtcggtgccgttgctccggtttatctggccgctgtgctcgagtatctgacc gctgagatcctggagctggctggaaacgccgctcgggacaacaagaagacccgtatcatc ccccgtcacctgcagctggcggtgcgcaacgacgaggagctgaacaaactcttgggcgga gtgaccatcgctcagggcggcgtgctgcccaacatccaggccgtgctgctgcccaagaag accgagaaacccgccaaaaccaaataa

DBGET integrated database retrieval system