Kaistella carnis: EIB73_05250 Help Entry EIB73_05250       CDS       T06869                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ccas  Kaistella carnis Brite KEGG Orthology (KO) [BR:ccas00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccas03032]     EIB73_05250    03036 Chromosome and associated proteins [BR:ccas03036]     EIB73_05250    03400 DNA repair and recombination proteins [BR:ccas03400]     EIB73_05250 DNA replication proteins [BR:ccas03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EIB73_05250 Chromosome and associated proteins [BR:ccas03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EIB73_05250 DNA repair and recombination proteins [BR:ccas03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EIB73_05250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AZI32633 UniProt:  A0A3G8XJJ9 LinkDB All DBs Position 1172518..1172820 Genome browser AA seq 100 aa AA seqDB search MNKSELIDAIAKDANITKVAAKAALESFISNVSETLKKKDGKVSLVGFGTFSVAERAARQ GINPATKKPIQIAAKKVAKFKAGADLASAVMEDMAPKKKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgctattgcaaaagacgcgaacatcacaaaagttgca gcaaaggcagctcttgaatcttttatttctaatgtttctgaaactttgaaaaagaaagac ggtaaagtatcactagtaggatttggaactttttctgtagctgaaagagctgcaagacaa ggaattaatccagcaactaagaaaccaattcaaattgcagcgaaaaaagttgctaaattc aaagctggagctgatctggcgagcgctgttatggaagatatggctccaaagaagaaaaaa taa

DBGET integrated database retrieval system