Kaistella carnis: EIB73_08980 Help Entry EIB73_08980       CDS       T06869                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccas  Kaistella carnis Pathway ccas01100   Metabolic pathways ccas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EIB73_08980    00074 Mycolic acid biosynthesis     EIB73_08980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EIB73_08980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF5783 DUF1409 Motif Other DBs NCBI-ProteinID:  AZI33305 UniProt:  A0A3G8XIJ6 LinkDB All DBs Position 1928867..1929106 Genome browser AA seq 79 aa AA seqDB search MSDIASRVKAIIADKLDVEETEVTPEASFTNDLGADSLDTVELIMEFEKEFNIQIPDDQA EKITTVGHAIAYIEEVVNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagtaaaagcgattatcgctgataaactcgacgttgaggaa acagaggtaactccagaagctagcttcacaaacgatttaggagctgattctttggatact gtagaattaatcatggaattcgaaaaagaatttaatattcagattccagatgatcaagca gaaaaaattactacggtaggacacgctattgcttacattgaagaagtagtgaacaaataa

DBGET integrated database retrieval system