KEGG   Ceratitis capitata (Mediterranean fruit fly): 101457647
Entry
101457647         CDS       T07533                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ccat  Ceratitis capitata (Mediterranean fruit fly)
Pathway
ccat00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ccat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    101457647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccat00199]
    101457647
Enzymes [BR:ccat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     101457647
Cytochrome P450 [BR:ccat00199]
 Cytochrome P450, animal type
  CYP306 family
   101457647
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101457647
NCBI-ProteinID: XP_012160905
LinkDB
Position
Unknown
AA seq 536 aa
MLAYYYWLAGFLVLLVIISEVRRAWRSRKYPRGPWGMPILGYLPFLDRREPYKTLAELAK
RYGPVYSLRLGNVDVVVLADAASVREFLKCEEFTARAPLYVTHGIMGGFGLICSEGALWR
NQRKHIIDWLKDLGMKKKQCNARKSMEQRIKSGVIECMKTFREDSKKKTAFNPHHALQHT
LGNIINELVFGVKYARDDVTWKYLQQLQEKGLKLIGVSGAVNFLPWLRFLPWNFRSIRFL
LEGKARTHEIYTKLIEKREKYWEYRKTIEEGNFNILDHFVDERMRRELSDEAQERLSTDI
YYTREQLLHLLADMFGAGLDTTLATMRWFLLYMCKYQEVQERLKSELETIPDAEFDLEHL
EQCHFLRACISEVQRIRSVVPLGIPHGAVEDFKIQGHLIPKNCMILPLQWSAHMMREKWI
EPEYYWPDRFLDPSEKYCQPADFIPFQTGKRMCPGEELARMMLLLYAGYIIRNFHIRLSS
TYEYMSMRGENGITLVPSYYEMVAQPRRNMKDLVKDHDVDMYKAVAMKKDIKSNTI
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgctggcatattactactggcttgccggcttcctcgtgctattagtcatcattagcgaa
gtgcgacgtgcttggcgatcacgaaaatatccacgagggccctggggcatgcctatactt
ggctatttgccctttctcgatagacgtgaaccatacaaaacattagcggaattagccaag
agatatggaccagtctattcgctgcggctgggcaatgtggatgtagtggtgctggccgat
gcggcgtcggtgcgagaatttctgaaatgtgaagaattcacagcgcgtgcaccgctctat
gtaacgcacggcataatgggtggattcggcctcatttgttcggaaggtgcgctttggcgc
aatcaacgcaagcacatcatcgactggctgaaagacttgggcatgaagaaaaagcaatgc
aatgcgcgtaaatcaatggagcagaggataaaaagtggcgttatagaatgtatgaagacc
tttagagaagattccaagaaaaagactgccttcaatccacaccatgccctgcagcataca
cttgggaatatcatcaacgaactggtgtttggcgtgaaatacgcacgcgatgacgtcact
tggaaatatttgcagcagctgcaggaaaagggtctgaaattgattggtgtctcaggtgct
gtgaactttttgccatggctgagattcttgccttggaactttcgctctatacgttttctt
ctcgagggcaaagcgcgtacacatgagatttacacaaagctgattgagaaacgtgaaaaa
tattgggagtatcgtaaaacaatagaggagggtaatttcaatatattagatcactttgta
gatgagcgcatgcgtcgcgagctctccgatgaagcacaagaacgtctctccaccgatata
tattacacacgagagcaattgttacatctattagcagatatgttcggcgctggattggat
acaacgttggcgacaatgcgttggtttttgctctacatgtgtaaatatcaggaggtgcag
gagcgtctcaagagtgaacttgagacaataccagatgctgaatttgatttggaacacctc
gaacagtgtcacttcttacgcgcttgcatctcggaagttcaacgtatacgctctgtagtg
cctttaggcataccccacggagctgttgaggacttcaaaatacaaggtcatttgataccg
aaaaattgcatgatactacctctgcaatggtctgcgcatatgatgcgtgaaaagtggata
gaaccggaatattattggcccgataggtttttggatccaagtgaaaaatattgtcagcct
gcggacttcattccattccaaacaggcaaacgcatgtgtccgggcgaagaacttgcacgt
atgatgctcctactctacgccggttacataatacgcaacttccacattcgattatcgtcc
acgtacgagtatatgagtatgcgtggtgaaaacggtataacattagtgccatcatattat
gaaatggtagcacaacccagacgcaatatgaaggatctggtgaaggatcatgatgtggac
atgtataaggcggtggcgatgaaaaaggatatcaaatcaaacacaatttaa

DBGET integrated database retrieval system