Corynebacterium canis: CCANI_10135 Help Entry CCANI_10135       CDS       T09233                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ccaw  Corynebacterium canis Pathway ccaw01056   Biosynthesis of type II polyketide backbone ccaw01100   Metabolic pathways ccaw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccaw00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CCANI_10135    00253 Tetracycline biosynthesis     CCANI_10135  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ccaw01004]     CCANI_10135    01008 Polyketide biosynthesis proteins [BR:ccaw01008]     CCANI_10135 Lipid biosynthesis proteins [BR:ccaw01004]  Polyketide synthase   Component type    CCANI_10135 Polyketide biosynthesis proteins [BR:ccaw01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CCANI_10135     Nonaketide PKS      CCANI_10135     Decaketide PKS      CCANI_10135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding VQ Motif Other DBs NCBI-ProteinID:  WJY75853 LinkDB All DBs Position 2241163..2241375 Genome browser AA seq 70 aa AA seqDB search MESAEQRLIALVQRVTGNDAAEIDLDAPLAFDSLTLIELAVRIEEEFGVRIDAFSPANLK EALALVTATA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggagtccgccgaacaacgcctcattgcgctggtacaacgcgtcacgggtaacgacgcc gctgagatcgaccttgacgctcccctagcgttcgattcgctcaccctcatcgaacttgca gttcgaattgaagaggagtttggggtgcgcatagatgcgttctcacctgcgaaccttaag gaggccctggcgctcgtgacagcgacggcgtga

DBGET integrated database retrieval system