Cupriavidus cauae: KZ686_09960 Help Entry KZ686_09960       CDS       T08639                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism ccax  Cupriavidus cauae Pathway ccax00361   Chlorocyclohexane and chlorobenzene degradation ccax00362   Benzoate degradation ccax00623   Toluene degradation ccax01100   Metabolic pathways ccax01120   Microbial metabolism in diverse environments ccax01220   Degradation of aromatic compounds Module ccax_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:ccax00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     KZ686_09960    00361 Chlorocyclohexane and chlorobenzene degradation     KZ686_09960    00623 Toluene degradation     KZ686_09960 Enzymes [BR:ccax01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      KZ686_09960     1.14.13.244  phenol 2-monooxygenase (NADH)      KZ686_09960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  UZN48166 LinkDB All DBs Position 1:2220586..2220942 Genome browser AA seq 118 aa AA seqDB search MSVVALKPYKFPARDARENFPAPLLFIGWEDHLLFAAPVALPLPSDTLFGALCTQVLPGT YGYHPDFSKIDWSQVQWFKSGQPWHPDPAKSLAENGLTHKDVIRFRTPGLNGLSGSCN NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagcgttgttgccctcaaaccctacaagttcccggcacgagacgcgcgcgaaaacttt ccggcgccgttgctgtttatcggctgggaagaccatctgttgtttgcggcaccagttgcc ttgcccctgccgtcggacacgttgttcggtgcgctgtgcacccaggtgttgcccggcact tatggctatcaccccgatttctcaaaaatcgactggagccaggtgcagtggtttaagtcc ggccagccgtggcatcccgacccggcgaagtcgctggctgaaaacggtctgacgcacaaa gacgtgatccgctttcgcacgcctggcttgaacggtctgagcggttcctgcaattga

DBGET integrated database retrieval system