Caretta caretta (Loggerhead turtle): 125620737 Help Entry 125620737         CDS       T09292                                  Name (RefSeq) metallothionein A   KO K14739   metallothionein 1/2 Organism ccay  Caretta caretta (Loggerhead turtle) Brite KEGG Orthology (KO) [BR:ccay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccay03019]     125620737    03029 Mitochondrial biogenesis [BR:ccay03029]     125620737 Messenger RNA biogenesis [BR:ccay03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125620737 Mitochondrial biogenesis [BR:ccay03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     125620737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  125620737 NCBI-ProteinID:  XP_048672769 LinkDB All DBs Position 12:complement(7573483..7575547) Genome browser AA seq 63 aa AA seqDB search MDPQDCLCATGGSCTCADSCKCKNCRCTSCKKSCCSCCPAGCNNCAKGCVCKDPATSKCS CCS NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatccccaggactgtctttgtgctaccggtggctcctgtacctgtgctgactcctgc aaatgcaagaattgcaggtgcacctcttgcaaaaagagttgttgctcctgttgcccagct ggatgcaataattgtgccaagggctgtgtctgcaaagatccagcaaccagtaaatgcagc tgctgttcttaa

DBGET integrated database retrieval system