Caretta caretta (Loggerhead turtle): 125623844 Help Entry 125623844         CDS       T09292                                  Name (RefSeq) CD59B glycoprotein-like   KO K04008   CD59 antigen Organism ccay  Caretta caretta (Loggerhead turtle) Brite KEGG Orthology (KO) [BR:ccay00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccay04147]     125623844    04090 CD molecules [BR:ccay04090]     125623844    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccay00537]     125623844 Exosome [BR:ccay04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125623844   Exosomal proteins of other body fluids (saliva and urine)    125623844   Exosomal proteins of colorectal cancer cells    125623844 CD molecules [BR:ccay04090]  Proteins   125623844 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccay00537]  Antigens   125623844 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 TM_HPP Motif Other DBs NCBI-GeneID:  125623844 NCBI-ProteinID:  XP_048679751 LinkDB All DBs Position 1:complement(214322709..214340297) Genome browser AA seq 89 aa AA seqDB search MRNLIVCALALALMAQAVVSLECYHCPNGARCFTTQKCRDDQDQCITMFFPFTAKYAKRC SRTYECEVMKAMGGSAVKAICCGTDRCNR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaggaacctgattgtgtgtgcgctcgccctagcgctgatggcacaagccgttgtgtct ctggagtgctatcactgccctaatggagcaagatgctttaccactcagaaatgcagggat gaccaggatcaatgtattaccatgttcttccctttcactgctaaatacgctaagcgatgc tccaggacgtatgaatgtgaagtcatgaaggccatgggggggtctgcagtgaaggccatt tgctgcggcactgatcggtgcaaccgatag

DBGET integrated database retrieval system