Caretta caretta (Loggerhead turtle): 125623929 Help Entry 125623929         CDS       T09292                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04060   Cytokine-cytokine receptor interaction ccay04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125623929  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125623929  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125623929    00536 Glycosaminoglycan binding proteins [BR:ccay00536]     125623929 Cytokines and neuropeptides [BR:ccay04052]  Cytokines   Chemokines    125623929 Glycosaminoglycan binding proteins [BR:ccay00536]  Heparan sulfate / Heparin   Chemokines    125623929 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125623929 NCBI-ProteinID:  XP_048680038 EnsemblRapid:  ENSCECG00000006392 LinkDB All DBs Position 17:3615034..3619743 Genome browser AA seq 91 aa AA seqDB search MKVCVAAFAVLLIAALCSQVHSQLDGVNTPTSCCFSHVAKPIPRSLVVKYRHTSSKCSLP AVIFTTKKGREVCSDPNARWVQEHVKHVKQN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctgtgtggctgccttcgcggttctcctcatcgctgccctctgctcccaggtc cattctcagcttgatggcgtcaacaccccaacttcctgctgcttcagccatgttgccaag ccaatcccacggagccttgtggtgaagtaccggcacaccagcagcaagtgctccttgcca gctgtaatctttaccacgaaaaaaggccgggaagtctgctccgatcccaacgcacgatgg gtccaggagcatgtcaagcacgtgaaacaaaactga

DBGET integrated database retrieval system