Caretta caretta (Loggerhead turtle): 125625144 Help Entry 125625144         CDS       T09292                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04010   MAPK signaling pathway ccay04012   ErbB signaling pathway ccay04068   FoxO signaling pathway ccay04137   Mitophagy - animal ccay04140   Autophagy - animal ccay04150   mTOR signaling pathway ccay04210   Apoptosis ccay04218   Cellular senescence ccay04370   VEGF signaling pathway ccay04371   Apelin signaling pathway ccay04540   Gap junction ccay04625   C-type lectin receptor signaling pathway ccay04810   Regulation of actin cytoskeleton ccay04910   Insulin signaling pathway ccay04912   GnRH signaling pathway ccay04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125625144 (NRAS)    04012 ErbB signaling pathway     125625144 (NRAS)    04370 VEGF signaling pathway     125625144 (NRAS)    04371 Apelin signaling pathway     125625144 (NRAS)    04068 FoxO signaling pathway     125625144 (NRAS)    04150 mTOR signaling pathway     125625144 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125625144 (NRAS)    04137 Mitophagy - animal     125625144 (NRAS)   09143 Cell growth and death    04210 Apoptosis     125625144 (NRAS)    04218 Cellular senescence     125625144 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     125625144 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125625144 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125625144 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     125625144 (NRAS)    04912 GnRH signaling pathway     125625144 (NRAS)    04916 Melanogenesis     125625144 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccay04131]     125625144 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccay04147]     125625144 (NRAS)    04031 GTP-binding proteins [BR:ccay04031]     125625144 (NRAS) Membrane trafficking [BR:ccay04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125625144 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     125625144 (NRAS) Exosome [BR:ccay04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125625144 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    125625144 (NRAS)   Exosomal proteins of breast cancer cells    125625144 (NRAS)   Exosomal proteins of colorectal cancer cells    125625144 (NRAS) GTP-binding proteins [BR:ccay04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125625144 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  125625144 NCBI-ProteinID:  XP_048682789 LinkDB All DBs Position 20:661669..668177 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggtgggagctggtggcgttggcaaaagcgccctgacc attcagctcatccagaaccactttgtggacgagtacgacccgaccatagaggattcatat cggaagcaggtagttattgatggtgagacctgtttgctagacattctggatactgcaggg caggaggagtacagcgctatgcgagaccagtacatgagaactggtgaaggcttcctctgt gtctttgccattaataacagcaaatcatttgctgatatcaatctctacagagagcagatt aagagagtgaaagattcagatgatgtgccaatggtgctagtgggaaacaagtgtgacttg cccacaaggacagtggatacaaaacaggctcaagaactagccaagagctatgggataccc ttcattgagacgtcagccaaaacaagacagggtgttgaagatgctttttacacattggtg agagagatccgccaataccggatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattgtcatgcattgtgatgtga

DBGET integrated database retrieval system