Caretta caretta (Loggerhead turtle): 125627605 Help Entry 125627605         CDS       T09292                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ccay  Caretta caretta (Loggerhead turtle) Brite KEGG Orthology (KO) [BR:ccay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ccay03041]     125627605 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125627605 (UBL5) Spliceosome [BR:ccay03041]  Complex B   Other components    Complex B specific factors     125627605 (UBL5) Cytokines and neuropeptides [BR:ccay04052]  Neuropeptides   Unclassified    125627605 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  125627605 NCBI-ProteinID:  XP_048687853 LinkDB All DBs Position 26:complement(12872289..12875179) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagttgtctgcaacgaccggctgggcaagaaagtccgcgtgaaatgcaacacg gaggacacgatcggcgacctgaagaaactcatcgcggctcagactgggacccggtgggac aaaattgtgctgaagaaatggtacacaatcttcaaggaccatgtatcactgggagactat gaaatccatgatggcatgaacctggagttatattatcagtag

DBGET integrated database retrieval system