Caretta caretta (Loggerhead turtle): 125628495 Help Entry 125628495         CDS       T09292                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04010   MAPK signaling pathway ccay04137   Mitophagy - animal ccay04140   Autophagy - animal ccay04218   Cellular senescence ccay04371   Apelin signaling pathway ccay04625   C-type lectin receptor signaling pathway ccay04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125628495 (RRAS)    04371 Apelin signaling pathway     125628495 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125628495 (RRAS)    04137 Mitophagy - animal     125628495 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     125628495 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125628495 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125628495 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccay04147]     125628495 (RRAS)    04031 GTP-binding proteins [BR:ccay04031]     125628495 (RRAS) Exosome [BR:ccay04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    125628495 (RRAS)   Exosomal proteins of bladder cancer cells    125628495 (RRAS) GTP-binding proteins [BR:ccay04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125628495 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF6806 Motif Other DBs NCBI-GeneID:  125628495 NCBI-ProteinID:  XP_048689505 LinkDB All DBs Position 27:2834732..2838977 Genome browser AA seq 202 aa AA seqDB search MVSKEPGAPQEKYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTIDGSPT RLDILDTAGQEEFGAMREQYMRTGEGFLLIYAINDRGSFTEISKFHTQILRVKDRDDFPM ILVGNKADLDLQRQVPKEEALAFAQENRIPYMEASAKIRLNVDESFHEVVRAIRRFQELE TPPAPTVHPTTKESNGCPCCIL NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggtctccaaagagccgggggcgccccaggagaaatacaagctggtggtggtgggaggg ggcggcgtggggaagagcgccctgaccatccagttcattcagtcgtactttgtctcggac tatgaccccacaatcgaggactcctacacgaagatttgcaccatcgatgggagcccgacc cggctggacatcctggacacggccgggcaggaggagttcggggccatgcgggagcagtac atgcgcacgggggaggggttcctgctcatctacgccatcaatgaccgcggcagcttcacc gagatcagcaagttccacacccagatcctgcgcgtcaaggaccgggacgactttcccatg atcctcgtgggcaacaaggctgacctggacctccagcgccaggtgcccaaggaggaggcg ctggccttcgcccaggagaatcgcatcccctacatggaggcctcggccaagatccgcctc aacgtagacgagtccttccatgaggtcgtccgggccatcagaaggttccaggagctggag accccccctgcccctacagtgcaccccacaactaaagagtccaacggctgcccctgctgc atcctgtga

DBGET integrated database retrieval system