Caretta caretta (Loggerhead turtle): 125631546 Help Entry 125631546         CDS       T09292                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04080   Neuroactive ligand-receptor interaction ccay04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     125631546 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     125631546 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125631546 (NPY) Cytokines and neuropeptides [BR:ccay04052]  Neuropeptides   GPCR binding    125631546 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  125631546 NCBI-ProteinID:  XP_048694381 LinkDB All DBs Position 2:61686357..61699910 Genome browser AA seq 97 aa AA seqDB search MQGTMRLWPSVLTFALSLLICLGTLAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLLRESTDNIPRSRFEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcaggggaccatgcggttgtggccgtcggtgctgactttcgccctgtccttgctgatc tgcctggggacgctggcggaggcgtatccatccaaaccggacaaccccggcgaggacgcg cctgcggaggacatggccagatactactcggcactgaggcactacatcaacctcatcacg aggcagagatatggaaagagatcaagcccagagacactgatctccgatcttttgttgaga gaaagcacagacaatattcctagatctaggtttgaagatccttctatgtggtga

DBGET integrated database retrieval system