Caretta caretta (Loggerhead turtle): 125636084 Help Entry 125636084         CDS       T09292                                  Name (RefSeq) C-X-C motif chemokine 11-like   KO K12672   C-X-C motif chemokine 11 Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04060   Cytokine-cytokine receptor interaction ccay04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125636084  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125636084  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125636084 Cytokines and neuropeptides [BR:ccay04052]  Cytokines   Chemokines    125636084 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125636084 NCBI-ProteinID:  XP_048704611 LinkDB All DBs Position 4:9895487..9899248 Genome browser AA seq 93 aa AA seqDB search MKSLIRLSLLLLLAAVLVQGMPTSSRGRCLCVTAGAPAIHPKHIAKVEIYGQSSSCQQVE VIITLKGSGQRKCLNSTSKLASRMIQKFLKRNN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaagtctcttattcgtctctcactcctgcttcttctggctgcagttctggtgcaagga atgccaacctccagcagaggacgctgtctttgtgtgacagctggtgcacctgcaatccac ccaaaacatattgcaaaggttgaaatatatgggcaaagcagcagctgtcagcaagtcgaa gtgatcatcacactgaaagggagcgggcaaagaaaatgtctgaacagcacatccaagcta gcatcacgcatgatacagaaattcttgaagagaaataactaa

DBGET integrated database retrieval system