Caretta caretta (Loggerhead turtle): 125636109 Help Entry 125636109         CDS       T09292                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04060   Cytokine-cytokine receptor interaction ccay04218   Cellular senescence ccay04620   Toll-like receptor signaling pathway ccay04621   NOD-like receptor signaling pathway ccay04622   RIG-I-like receptor signaling pathway ccay05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125636109  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125636109  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125636109    04621 NOD-like receptor signaling pathway     125636109    04622 RIG-I-like receptor signaling pathway     125636109  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125636109  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125636109    00536 Glycosaminoglycan binding proteins [BR:ccay00536]     125636109 Cytokines and neuropeptides [BR:ccay04052]  Cytokines   Chemokines    125636109 Glycosaminoglycan binding proteins [BR:ccay00536]  Heparan sulfate / Heparin   Chemokines    125636109 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125636109 NCBI-ProteinID:  XP_048704658 LinkDB All DBs Position 4 Genome browser AA seq 97 aa AA seqDB search MDNKITLSLLLLTLTGFCHESLLGGELRRRCLQTASGLRSPKHLVHVEIVPKGPQCGTVE VIATLKTSQQICLDPEAKWVKMIIKRILCSSSGRLRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggacaacaagatcacattgtccctcctgctgcttactctcacaggcttctgtcatgag tcacttctgggtggagagttgcggcgtcggtgtctccagacggcctcgggcttgaggtca ccaaagcacttggtacatgtggaaatcgtccccaaaggcccacagtgcggcaccgtggaa gtcattgcgacattgaagacgagccagcaaatctgtttggatcccgaggccaaatgggtg aagatgataattaagaggattttatgcagctcatccggcagactgcgcaaatag

DBGET integrated database retrieval system