Caretta caretta (Loggerhead turtle): 125638588 Help Entry 125638588         CDS       T09292                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04010   MAPK signaling pathway ccay04068   FoxO signaling pathway ccay04081   Hormone signaling ccay04114   Oocyte meiosis ccay04140   Autophagy - animal ccay04150   mTOR signaling pathway ccay04810   Regulation of actin cytoskeleton ccay04910   Insulin signaling pathway ccay04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ccay00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125638588 (INS)    04068 FoxO signaling pathway     125638588 (INS)    04150 mTOR signaling pathway     125638588 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     125638588 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125638588 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     125638588 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125638588 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     125638588 (INS)    04914 Progesterone-mediated oocyte maturation     125638588 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccay04052]     125638588 (INS) Cytokines and neuropeptides [BR:ccay04052]  Neuropeptides   Unclassified    125638588 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  125638588 NCBI-ProteinID:  XP_048710507 LinkDB All DBs Position 6:complement(20057652..20059873) Genome browser AA seq 106 aa AA seqDB search MALWIQSLPLLVLLALSGLTISHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDLEQ PLANGHLQNAVEELPFQQEYQQEKRGIVEQCCHSTCSLYQLENYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccaatcactgcctctcctggtcctccttgctctttccggcctcacg atcagccatgctgctgccaaccagcacctctgcggctcacacctagtggaggccctctat ctggtgtgcggagaacggggcttcttctactctcccaaagcccgacgggacctcgagcag cccctagctaatggccatctgcagaatgcggtggaagaactgccattccaacaggaatac cagcaagagaagaggggaattgttgagcaatgttgccatagcacctgctccctgtaccag ctggaaaactactgcaattag

DBGET integrated database retrieval system