Caretta caretta (Loggerhead turtle): 125640414 Help Entry 125640414         CDS       T09292                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccay00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125640414  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccay04121]     125640414    03400 DNA repair and recombination proteins [BR:ccay03400]     125640414 Ubiquitin system [BR:ccay04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      125640414    Cul5 complex      125640414 DNA repair and recombination proteins [BR:ccay03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125640414 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  125640414 NCBI-ProteinID:  XP_048714868 LinkDB All DBs Position 7 Genome browser AA seq 121 aa AA seqDB search MDVFLMIRRHKMTIFADAKETTTVQELKKIVGGILKRPPEEQQLYKDDWLLEDGDRTLIE CGLSSQTSRPHAPAMVGLALFRASEGSFEPLHIDPFSSTPELPDVLKPQDSGSSSGELPM Q NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcttgatgatccgtcgccacaaaatgaccatctttgctgatgccaaggag actaccactgtgcaggagctgaagaagattgtggggggcatcctgaagaggcctccggag gagcagcagctatacaaggatgactggttgctggaggatggtgacaggaccttgatagaa tgtgggttaagcagccagacttcccgtccccatgcgccagccatggtgggcttggcctta ttcagagccagtgagggctcctttgagccattgcacattgaccccttctccagcacccct gagctgcctgatgttttgaagcctcaagattctggcagcagctctggcgagctgcccatg cagtga

DBGET integrated database retrieval system