Couchioplanes caeruleus: COUCH_06180 Help Entry COUCH_06180       CDS       T08133                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ccaz  Couchioplanes caeruleus Brite KEGG Orthology (KO) [BR:ccaz00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     COUCH_06180 Enzymes [BR:ccaz01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      COUCH_06180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  UQU65897 LinkDB All DBs Position complement(1283895..1284137) Genome browser AA seq 80 aa AA seqDB search MLTMYSTPWCGYCHRLKSQLDREGIAYEVIDIEQDPKAADYVMSVNGGNQTVPTMRFDDG TAMTNPSIVQVKQHLASLTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgaccatgtactcgacgccctggtgtggctactgccaccggctcaagtcgcagctc gaccgggagggcatcgcgtacgaagtcatcgacatcgagcaggacccgaaggccgccgac tacgtgatgagcgtgaacggcggcaaccagacggtcccgacgatgcgcttcgacgacggc accgcgatgaccaacccgtcgatcgtccaggtcaagcagcacctggcgagcctgacggcc tga

DBGET integrated database retrieval system