KEGG   Couchioplanes caeruleus: COUCH_15960
Entry
COUCH_15960       CDS       T08133                                 
Name
(GenBank) FAD-dependent monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
ccaz  Couchioplanes caeruleus
Pathway
ccaz00253  Tetracycline biosynthesis
ccaz01057  Biosynthesis of type II polyketide products
ccaz01100  Metabolic pathways
ccaz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccaz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    COUCH_15960
   00253 Tetracycline biosynthesis
    COUCH_15960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ccaz01008]
    COUCH_15960
Enzymes [BR:ccaz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     COUCH_15960
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     COUCH_15960
Polyketide biosynthesis proteins [BR:ccaz01008]
 Polyketide tailoring proteins
  Oxygenase
   COUCH_15960
SSDB
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 HI0933_like Pyr_redox_2 Pyr_redox FAD_binding_2
Other DBs
NCBI-ProteinID: UQU67672
LinkDB
Position
3435564..3437102
AA seq 512 aa
MDFDVIVVGGGPVGALLAAELRLGGARAVVLERLTEPSGHSKAFRLQPRTLELFDQRGIL
ERFLEGNRIWPRAHFAGIEPLLELDRLDAAHPHALLIPQARTEELLEKHALDLGAEIRRG
HELTGLAAGGDEVVARVRSAAGEYELRAAYLVGCDGGRSTVRRLAGIGFTGTDPSVSALL
GDVELPEPGQLPAGVPGTMRTPRGLLMAISVLPGVTRVLTTEFDRPLPDRDTPVTLDELR
TTVERVTGLQVTMREPRWLSRFTDATRLADEYRTGRVLLAGDAAHVHFPIGAQGLNLGLQ
DAMNLGWKLAATVAGWAPDGLLDSYGAERRPAAVRVLRETRAQVALMNPEPRVDALRDLV
GDLLALPEVNLWLSRELSGLDVRYESMAGDAGHPLVGRPCPALTADAGAGPVPAATLLRN
GRGLLLLPPDATDPATAGWADRVDVLPDVRLDAGDRSDVPAALLLRPDGHVAWAGATGPD
GAAALGAALHRWFGAPHELTSTVDHAQNRGTS
NT seq 1539 nt   +upstreamnt  +downstreamnt
ttggacttcgacgtgatcgtcgtcggcggcggacccgtcggcgcattgctcgccgcggag
ctgcggctcggcggcgcgcgggcggtggtgctggaacggctcaccgagccgagcgggcac
tcgaaggccttccgcctgcaaccgcggacgctggagctcttcgaccagcgcggcatcctc
gagcggttcctcgagggcaaccggatctggccccgggcccacttcgccggcatcgaaccc
ctgctggaactcgacaggctggacgcggcgcacccgcacgccctgctgatcccgcaggcc
cgcaccgaggaactgctcgagaagcacgccctcgacctgggcgccgagatccgccgcggg
cacgagctgaccgggctggccgccggcggcgacgaggtggtggcccgggtccgttccgcc
gccggcgagtacgagctgcgtgcggcgtacctggtgggctgtgacggcgggcgcagcacg
gtccgccggctcgccggcatcgggttcaccggcacggatccgagcgtgagcgcgctcctg
ggcgacgtggagctgcccgagcccggacagctgccggccggcgtgccgggcaccatgcgg
acgccgcgcggcctgctcatggcgatctccgtgctgcccggggtgacccgggtgctgacc
accgagttcgaccggcccctgccggaccgggacaccccggtcacgctcgacgagcttcgg
accactgtggagcgcgtcaccggcctgcaggtcaccatgcgcgagccgcggtggctctcc
cggttcaccgacgccacccggctggccgacgagtaccgcaccgggcgcgtcctgctcgcg
ggcgacgcggcgcacgtgcacttcccgatcggcgcgcaggggctgaacctgggcctgcag
gacgcgatgaacctgggctggaagctggcggccaccgtcgccgggtgggccccggacggg
ttgctggacagctacggcgccgagcgccggccggctgcggtccgggtgctgcgcgagacc
cgggcccaggtggcgttgatgaatccggagccccgcgtcgacgcgctgcgtgacctggtc
ggggacctgctggccctgcccgaggtcaacctgtggctgtcgcgggagctgtccggcctg
gacgtgcgctacgagagcatggccggcgacgccggccacccgctggtgggccggccctgc
ccggcactgaccgccgatgccggcgccggccccgtgccggccgccacgctgctgcgcaac
ggccgcggcctcctgctgctgccgccggacgctacggaccccgccaccgccgggtgggcc
gaccgcgtcgacgtgctgccggacgtacgcctcgacgccggtgaccgcagcgacgtgccc
gcggcgctgctgctgcggccggacggacacgtcgcgtgggccggcgccaccggaccggac
ggggccgccgcgctcggcgccgcgctgcaccggtggttcggcgcgccgcacgagctcacc
tcaaccgtggaccacgcgcagaaccgggggacttcgtga

DBGET integrated database retrieval system