Clostridium cellulovorans: Clocel_4143 Help Entry Clocel_4143       CDS       T01294                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism ccb  Clostridium cellulovorans Pathway ccb00998   Biosynthesis of various antibiotics ccb01100   Metabolic pathways ccb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Clocel_4143    00074 Mycolic acid biosynthesis     Clocel_4143   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Clocel_4143 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADL53804 UniProt:  D9SME8 LinkDB All DBs Position complement(5000751..5000975) Genome browser AA seq 74 aa AA seqDB search MVFEKIKEIICDQLGVDEDRITLETTFEELGADSLDLFQVIIEIEEAYNIQLEEAESIKT VNDAVEYVESKIEN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggtatttgaaaagattaaggaaataatatgtgatcaattaggtgtggacgaggatcgt ataacacttgaaactacattcgaagaattaggagctgattctttagatttatttcaggta ataatcgaaatagaagaggcatataatattcagcttgaagaagcagaaagtattaaaaca gttaatgatgcagtggaatatgttgaatcaaaaatagaaaattaa

DBGET integrated database retrieval system