Ruminiclostridium cellulolyticum: Ccel_0685 Help Entry Ccel_0685         CDS       T00835                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cce  Ruminiclostridium cellulolyticum Pathway cce01100   Metabolic pathways cce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ccel_0685    00074 Mycolic acid biosynthesis     Ccel_0685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ccel_0685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 PP-binding_2 MCM_C Flagellin_IN Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ACL75065 UniProt:  B8I7Q8 LinkDB All DBs Position 790098..790325 Genome browser AA seq 75 aa AA seqDB search MVFDKVKKLVVEQLGVEEGDITMESSFIDDLGADSLDIVELIMALEEEFGLEIPDSEAEK ITTVKDVVEYINSNT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtttttgataaagtaaaaaaattggttgttgagcagttaggtgttgaagaaggcgat ataactatggaatcttctttcatagatgatcttggagctgattctcttgatatagtagag cttataatggctctagaagaggaatttggtcttgagatacctgatagcgaagcagagaag atcacaacagttaaagatgttgttgaatacatcaatagtaatacttaa

DBGET integrated database retrieval system