Ruminiclostridium cellulolyticum: Ccel_2375 Help Entry Ccel_2375         CDS       T00835                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism cce  Ruminiclostridium cellulolyticum Pathway cce01100   Metabolic pathways cce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ccel_2375    00074 Mycolic acid biosynthesis     Ccel_2375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ccel_2375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding BT_4170-like_C DUF6252 Motif Other DBs NCBI-ProteinID:  ACL76708 UniProt:  B8I5H2 LinkDB All DBs Position complement(2798962..2799207) Genome browser AA seq 81 aa AA seqDB search MSEMVETRLKKVIKENYKASDIADNIRVDETLATFGLNSVEFVKLVVMLENEFGFEFDNE HLDFAKFSTIRDIVDYVESKI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaatggtggaaacgagattaaaaaaggttataaaggaaaattacaaggcttcg gatattgccgataatatcagagtggatgagactttggctacgtttggtttgaattcggta gaatttgtaaaattagtggtgatgcttgaaaatgaatttgggtttgaatttgataatgag catcttgactttgccaagttttctactataagagatatcgtggactacgttgaaagcaaa atatga

DBGET integrated database retrieval system