Clostridium cellulosi: CCDG5_0353 Help Entry CCDG5_0353        CDS       T03806                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism ccel  Clostridium cellulosi Pathway ccel02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ccel00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CCDG5_0353  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ccel02035]     CCDG5_0353 Bacterial motility proteins [BR:ccel02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     CCDG5_0353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FliE Motif Other DBs NCBI-ProteinID:  CDZ23492 UniProt:  A0A078KLY0 LinkDB All DBs Position I:373202..373507 Genome browser AA seq 101 aa AA seqDB search MDIQALSGINSVTPQLVQQASSNKGNDAVSMFSSIYDQLVDNVNKTNAAFEGDIVKAAEG ELDNPHQLLIDSAKANISLQLLLSVRNTALEAYNDIMKMSV NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggatattcaggcattatcggggattaattctgtaacgcctcagttagtgcagcaggca agttcaaataaaggtaacgacgcagtttcaatgttcagttccatttatgatcaactggta gataatgttaataagacaaatgcagcttttgaaggcgatatagtaaaagctgccgagggc gaactcgataaccctcatcaactgctgattgacagcgcaaaggcaaatatatcgctccaa cttttattgagtgtgagaaacactgcactcgaggcgtataacgacatcatgaaaatgtca gtgtaa

DBGET integrated database retrieval system